PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC06G25350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 173aa    MW: 18695 Da    PI: 8.7113
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC06G25350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_157.72.6e-18101158360
                      XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                      +++r++r+++NRe+A rsR+RK+a++eeLe++v  L   N  Lkk+ +elk+eva+l 
  OPUNC06G25350.1 101 DDRRTIRMMRNRESALRSRARKRAYVEELEKEVRRLVDDNLNLKKQCKELKQEVAALV 158
                      589***************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.8E-1699157No hitNo description
SMARTSM003384.6E-1599163IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.783101157IPR004827Basic-leucine zipper domain
PfamPF001702.6E-15102158IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.39E-13103157No hitNo description
CDDcd147072.43E-17103157No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MANYHHQEYY QMAAAAAAWP REPDSPQLSI MSGCSSLFSI STLRDDDDGG GGGGGGGALV  60
RLAHAGLPAT PVSLAGIAGA STPGGDEVDM EVRQQSGGSG DDRRTIRMMR NRESALRSRA  120
RKRAYVEELE KEVRRLVDDN LNLKKQCKEL KQEVAALVMP TKSSLRRTSS TQF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2431441e-161AK243144.1 Oryza sativa Japonica Group cDNA, clone: J100032B03, full insert sequence.
GenBankCT8347451e-161CT834745.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA103J07, full insert sequence.
GenBankCT8347471e-161CT834747.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA126G01, full insert sequence.
GenBankCT8347481e-161CT834748.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA223H09, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642449.11e-106PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643092.11e-106PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643093.11e-106PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643094.11e-106PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643106.11e-106PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643107.11e-106PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0E0LFS51e-125A0A0E0LFS5_ORYPU; Uncharacterized protein
STRINGLOC_Os06g50830.11e-106(Oryza sativa Japonica Group)
STRINGLOC_Os06g50600.11e-106(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.14e-11bZIP family protein